PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400056261
Common NameLOC102606061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 332aa    MW: 37366.8 Da    PI: 6.1155
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400056261genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY73.72.4e-23129185258
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                           +Dg +WrKYGqK + g ++pr YYrC  + C+++k v+r +++p ++e+tY g+H +
  PGSC0003DMP400056261 129 EDGLSWRKYGQKLILGEKYPREYYRCPRRCCEATKMVQRIETEPLTFEVTYGGSHSC 185
                           7******************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-23117187IPR003657WRKY domain
PROSITE profilePS5081119.267123184IPR003657WRKY domain
SuperFamilySSF1182906.41E-22126187IPR003657WRKY domain
SMARTSM007741.3E-24128187IPR003657WRKY domain
PfamPF031069.5E-22129185IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGENNFWERE IVIAELTKGK ELMLQLQKHF DPMKQLVCQY LAVEILSSYD KAMSLLNGTA  60
LSGMMKSKGK EIIHPAPSSS TAPQLESPHL LADSSTKSCD RPSNYRKRKM LARRKEYVEA  120
RPGEEVPPED GLSWRKYGQK LILGEKYPRE YYRCPRRCCE ATKMVQRIET EPLTFEVTYG  180
GSHSCGQETK NQNEELIAVQ QTKCDEVGRG AGQIFESYIH KMVSTPNNSY NNSSTGVEFS  240
NSNSVFNIPN SDFIPTPTSS PHPDMDFPFD YSSFTHLFGQ DVPDNSGNDS LAALAAEVYK  300
LYEENGKLNF PHRYDKQAEN SRPSNNVGDQ S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345566.10.0PREDICTED: probable WRKY transcription factor 41
TrEMBLM1D7K80.0M1D7K8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000842140.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120611123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11070.14e-20WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]